Structure of PDB 6a4x Chain A |
>6a4xA (length=127) Species: 146536 (Streptomyces curacoi) [Search protein sequence] |
MTVQLNHTIVAAHDKKASARFLADILGLEVSPQYGPFIPVEIPNGVSLDY LDSRGAITPQHYAFLVSEDDFDTIFGRIREAGLTYWADPYHRRPGEINHN DGGRGAYFEDPNGHNLEILTRPYGSGG |
|
PDB | 6a4x Molecular Basis for the Final Oxidative Rearrangement Steps in Chartreusin Biosynthesis. |
Chain | A |
Resolution | 1.63 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE2 |
A |
H61 E117 Y123 |
H61 E117 Y123 |
|
|
|
|