Structure of PDB 6a4j Chain A

Receptor sequence

>6a4jA (length=340) Species: 1280 (Staphylococcus aureus)

MKDVTIIGGGPSGLYASFYAGLRDMSVRLIDVQSELGGKMRIYPEKIIWD
IGGIAPKPCHEILKDTIKQGLYFKPEVHLNERVVDIRKKAERHFEVETEA
GEIYTSKAVIIAIGAGIINPKQLDVKGVERYQLTNLHYVVQSYRRFKDKD
VLISGGGNTALDWAHDIAKIAKSVTVVYRKEDVSGHEAMKTLVTDLNVKL
CPKTRIKYLVGTHISEVVLEHVESGDRHTVKFDDVIISHGFDRCNTLLSE
TSSKLDMHDDCRVKGFGNTTTSIPGIYACGDIVYHDAKSHLIASAFSDGA
NAANLAKTYIQPDANAEGYVSSHHEVFKEANKTIVNKHLY

3D structure

• PDB: 6a4j Elucidation of the mechanism of disulfide exchange between staphylococcal thioredoxin2 and thioredoxin reductase2: A structural insight.
• Chain: A
• Resolution: 3.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Q141 S142
• Catalytic site (residue number reindexed from 1): Q141 S142
• Enzyme Commision number: 1.18.1.2: ferredoxin--NADP(+) reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	G10 P11 S12 D31 V32 Q33 G38 K39 Y43 D50 V83 I113 G114 G116 I117 V139 F245 D285 I296	G10 P11 S12 D31 V32 Q33 G38 K39 Y43 D50 V83 I113 G114 G116 I117 V139 F241 D281 I292

Gene Ontology

Molecular Function

• GO:0004324 ferredoxin-NADP+ reductase activity
• GO:0004791 thioredoxin-disulfide reductase (NADPH) activity
• GO:0016491 oxidoreductase activity
• GO:0050660 flavin adenine dinucleotide binding
• GO:0050661 NADP binding

Biological Process

• GO:0045454 cell redox homeostasis
• GO:0098869 cellular oxidant detoxification

External links

• PDB: RCSB:6a4j, PDBe:6a4j, PDBj:6a4j
• PDBsum: 6a4j
• PubMed: 30710560
• UniProt: Q2FVP8|FENR_STAA8 Ferredoxin--NADP reductase (Gene Name=SAOUHSC_02654)