Structure of PDB 6a36 Chain A

Receptor sequence

>6a36A (length=331) Species: 31958 (Amycolatopsis orientalis)

YVSLADLERAARDVLPGEIFDFLAGGSGTEASLVANRTALERVFVIPRML
RDLTDVTTEIDIFGRRAALPMAVAPVAYQRLFHPEGELAVARAARDAGVP
YTICTLSSVSLEEIAAVGGRPWFQLFWLRDEKRSLDLVRRAEDAGCEAIV
FTVDVPWMGRRLRDMRNGFALPEWVTAANFEFAPATWESVEAVRAHTDLP
VVLKGILAVEDARRAVDAGAGGIVVSNHGGRQLDGAVPGIEMLGEIVAAV
SGGCEVLVDGGIRSGGDVLKATALGASAVLVGRPVMWALAAAGQDGVRQL
LELLAEEVRDAMGLAGCESVGAARRLNTKLG

3D structure

• PDB: 6a36 Structural and chemical trapping of flavin-oxide intermediates reveals substrate-directed reaction multiplicity.
• Chain: A
• Resolution: 1.44 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): F128 D156 H252
• Catalytic site (residue number reindexed from 1): F126 D154 H228
• Enzyme Commision number: 1.1.3.46: 4-hydroxymandelate oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	9P9	A	L25 P77 V78 A79 Q126 F128 T154 M160 R163 K228 H252 R255 D283 G284 G285 R287 G306 R307	L23 P75 V76 A77 Q124 F126 T152 M158 R161 K204 H228 R231 D259 G260 G261 R263 G282 R283
BS02	9PF	A	P77 V78 Q126 F128 T154 K228 H252 R255 D283 G284 G285 R287 G306 R307	P75 V76 Q124 F126 T152 K204 H228 R231 D259 G260 G261 R263 G282 R283

Gene Ontology

Molecular Function

• GO:0004459 L-lactate dehydrogenase activity
• GO:0010181 FMN binding
• GO:0016491 oxidoreductase activity
• GO:0016899 oxidoreductase activity, acting on the CH-OH group of donors, oxygen as acceptor

Biological Process

• GO:0017000 antibiotic biosynthetic process
• GO:0033072 vancomycin biosynthetic process

External links

• PDB: RCSB:6a36, PDBe:6a36, PDBj:6a36
• PDBsum: 6a36
• PubMed: 32362037
• UniProt: O52792|HMO_AMYOR 4-hydroxymandelate oxidase (Gene Name=hmo)