Structure of PDB 5zvm Chain A

Receptor sequence
>5zvmA (length=69) [Search protein sequence]
TQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNT
LVKQLSSNFGAISSVLNDI
3D structure
PDB5zvm A pan-coronavirus fusion inhibitor targeting the HR1 domain of human coronavirus spike.
ChainA
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A Q902 F909 N910 I913 S914 Q917 L920 T921 S924 L927 G928 Q931 N935 A938 Q939 Q9 F16 N17 I20 S21 Q24 L27 T28 S31 L34 G35 Q38 N42 A45 Q46
Gene Ontology
Biological Process
GO:0019064 fusion of virus membrane with host plasma membrane
GO:0039654 fusion of virus membrane with host endosome membrane
GO:0046813 receptor-mediated virion attachment to host cell
GO:0075509 endocytosis involved in viral entry into host cell
Cellular Component
GO:0016020 membrane
GO:0019031 viral envelope
GO:0055036 virion membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zvm, PDBe:5zvm, PDBj:5zvm
PDBsum5zvm
PubMed30989115
UniProtP59594|SPIKE_SARS Spike glycoprotein (Gene Name=S)

[Back to BioLiP]