Structure of PDB 5zut Chain A

Receptor sequence

>5zutA (length=255) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSL
EIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSII
LLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRD
LSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMD
QPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFL
APKFN

3D structure

PDB

5zut Crystal Structure of Yeast PCNA in Complex with N24 Peptide

Chain

Resolution

2.82 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	N27 V40 D41 R44 D120 I121 E129 L131 E232 A233 P234 A251 P252	N27 V40 D41 R44 D120 I121 E129 L131 E232 A233 P234 A251 P252

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0030337	DNA polymerase processivity factor activity
GO:0042802	identical protein binding

	Biological Process
GO:0000278	mitotic cell cycle
GO:0000710	meiotic mismatch repair
GO:0006260	DNA replication
GO:0006272	leading strand elongation
GO:0006273	lagging strand elongation
GO:0006275	regulation of DNA replication
GO:0006281	DNA repair
GO:0006289	nucleotide-excision repair
GO:0006298	mismatch repair
GO:0006301	postreplication repair
GO:0007064	mitotic sister chromatid cohesion
GO:0019985	translesion synthesis
GO:0030466	silent mating-type cassette heterochromatin formation
GO:0031509	subtelomeric heterochromatin formation
GO:0034087	establishment of mitotic sister chromatid cohesion
GO:0035753	maintenance of DNA trinucleotide repeats
GO:0045739	positive regulation of DNA repair
GO:0045740	positive regulation of DNA replication
GO:0051054	positive regulation of DNA metabolic process
GO:0070987	error-free translesion synthesis

	Cellular Component
GO:0000781	chromosome, telomeric region
GO:0005634	nucleus
GO:0005657	replication fork
GO:0043626	PCNA complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5zut, PDBe:5zut, PDBj:5zut
PDBsum	5zut
PubMed
UniProt	P15873\|PCNA_YEAST Proliferating cell nuclear antigen (Gene Name=POL30)

[Back to BioLiP]