Structure of PDB 5zun Chain A

Receptor sequence
>5zunA (length=289) Species: 9606 (Homo sapiens) [Search protein sequence]
PRRTPQSIPYQDLPHLVNADGQYLFCRYWAPTGTPKALIFVSHGAGEHSG
RYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDS
MQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESA
TTFKVLAAKVLNSVLPNLSSGPIDSSVLSRNKTEVDIYNSDPLICRAGLK
VCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKS
QDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTA
3D structure
PDB5zun Design, Synthesis, and Evaluation of Piperazinyl Pyrrolidin-2-ones as a Novel Series of Reversible Monoacylglycerol Lipase Inhibitors
ChainA
Resolution1.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.1.23: acylglycerol lipase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 9JX A G50 A51 E53 R57 H121 S122 M123 I179 S181 S185 E190 V191 Y194 L205 L241 V270 K273 G44 A45 E47 R51 H115 S116 M117 I173 S175 S179 E184 V185 Y188 L199 L235 V264 K267 MOAD: ic50=0.64nM
PDBbind-CN: -logKd/Ki=9.19,IC50=0.64nM
BindingDB: IC50=0.640000nM
Gene Ontology
Molecular Function
GO:0004622 lysophospholipase activity
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
GO:0047372 monoacylglycerol lipase activity
GO:0052689 carboxylic ester hydrolase activity
Biological Process
GO:0006629 lipid metabolic process
GO:0006633 fatty acid biosynthetic process
GO:0006639 acylglycerol metabolic process
GO:0006954 inflammatory response
GO:0009966 regulation of signal transduction
GO:0016042 lipid catabolic process
GO:0019369 arachidonate metabolic process
GO:0019433 triglyceride catabolic process
GO:0046464 acylglycerol catabolic process
GO:0050727 regulation of inflammatory response
GO:0051930 regulation of sensory perception of pain
GO:0052651 monoacylglycerol catabolic process
GO:2000124 regulation of endocannabinoid signaling pathway
Cellular Component
GO:0005737 cytoplasm
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zun, PDBe:5zun, PDBj:5zun
PDBsum5zun
PubMed30251836
UniProtQ99685|MGLL_HUMAN Monoglyceride lipase (Gene Name=MGLL)

[Back to BioLiP]