Structure of PDB 5ztb Chain A

Receptor sequence

>5ztbA (length=307) Species: 262724 (Thermus thermophilus HB27)

VCKVCGQKAQVEMRSRGLALCREHYLDWFVKETERAIRRHRMLLPGERVL
VAVSGGKDSLALWDVLSRLGYQAVGLHIELGIGEYSKRSLEVTQAFARER
GLELLVVDLKEAYGFGVPELARLSGRVACSACGLSKRYIINQVAVEEGFR
VVATGHNLDDEAAVLFGNLLNPLSRQGPVLPEKPGLAARVKPFYRFSERE
VLSYTLLRGIRYLHEECPNAKGAKSLLYKEALNLVERSMPGAKLRFLDGF
LEKIRPRLALRECERCGYPTTGAVCAFCRMWDAVYRRAKKRKLLPEEVSF
RPRVKPL

3D structure

• PDB: 5ztb The [4Fe-4S] cluster of sulfurtransferase TtuA desulfurizes TtuB during tRNA modification in Thermus thermophilus.
• Chain: A
• Resolution: 2.2 Å

Enzymatic activity

• Enzyme Commision number: 2.8.1.15: tRNA-5-methyluridine(54) 2-sulfurtransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	A	I83 C130 C133 C222 N224	I82 C129 C132 C217 N219
BS02	ZN	A	C6 C22 H25	C5 C21 H24
BS03	ZN	A	C274 C277 C286 C289	C263 C266 C275 C278
BS04	ATP	A	A53 V54 S55 G57 D59 S60 I79 K137 G156 H157	A52 V53 S54 G56 D58 S59 I78 K136 G155 H156

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0005524 ATP binding
• GO:0016740 transferase activity
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0002098 tRNA wobble uridine modification
• GO:0002143 tRNA wobble position uridine thiolation
• GO:0008033 tRNA processing
• GO:0034227 tRNA thio-modification

Cellular Component

• GO:0002144 cytosolic tRNA wobble base thiouridylase complex

External links

• PDB: RCSB:5ztb, PDBe:5ztb, PDBj:5ztb
• PDBsum: 5ztb
• PubMed: 32265486
• UniProt: Q72LF3|TTUA_THET2 tRNA-5-methyluridine(54) 2-sulfurtransferase (Gene Name=ttuA)