Structure of PDB 5zjr Chain A

Receptor sequence
>5zjrA (length=64) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
EWTRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIW
FQNRRMKNKKNSQR
3D structure
PDB5zjr Intrinsic DNA Shape Accounts for Affinity Differences between Hox-Cofactor Binding Sites.
ChainA
Resolution3.03 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R23 Y43 Q68 R71 M72 K75 R7 Y27 Q52 R55 M56 K59
BS02 dna A R23 K24 P25 Y26 R61 Q62 I65 N69 K73 R7 K8 P9 Y10 R45 Q46 I49 N53 K57
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5zjr, PDBe:5zjr, PDBj:5zjr
PDBsum5zjr
PubMed30157419
UniProtP09087|ABDB_DROME Homeobox protein abdominal-B (Gene Name=Abd-B)

[Back to BioLiP]