Structure of PDB 5zc9 Chain A

Receptor sequence

>5zc9A (length=378) Species: 9606 (Homo sapiens) [Search protein sequence]

EIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQS
GTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMG
ASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKM
FVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFM
RDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIF
INTRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLIT
TDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTE
EDKRTLRDIETFYNTSIEEMPLNVADLI

3D structure

PDB

5zc9 The Translation Inhibitor Rocaglamide Targets a Bimolecular Cavity between eIF4A and Polypurine RNA.

Chain

Resolution

2.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.4.13: RNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	P108 T109 R110 G136 G137 V140 T158 P159 G160 R161 D164 R168 R190 G191 F192 Q195 N280 T281 R282 H303 G304 R311 T329 D330 L331	P80 T81 R82 G108 G109 V112 T130 P131 G132 R133 D136 R140 R162 G163 F164 Q167 N252 T253 R254 H275 G276 R283 T301 D302 L303	PDBbind-CN: Kd=7.6uM
BS02	ANP	A	F52 Q59 G79 G81 K82 T83 G335 D337 R362 R365 F366	F24 Q31 G51 G53 K54 T55 G307 D309 R334 R337 F338
BS03	RCG	A	F163 Q195	F135 Q167	BindingDB: IC50=47nM,Kd=156nM

Gene Ontology

	Molecular Function
GO:0000339	RNA cap binding
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003724	RNA helicase activity
GO:0003725	double-stranded RNA binding
GO:0003729	mRNA binding
GO:0003743	translation initiation factor activity
GO:0004386	helicase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0008135	translation factor activity, RNA binding
GO:0016787	hydrolase activity
GO:0016887	ATP hydrolysis activity

	Biological Process
GO:0002183	cytoplasmic translational initiation
GO:0006412	translation
GO:0006413	translational initiation
GO:0045944	positive regulation of transcription by RNA polymerase II

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0016281	eukaryotic translation initiation factor 4F complex
GO:0048471	perinuclear region of cytoplasm
GO:0070062	extracellular exosome
GO:0097165	nuclear stress granule

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5zc9, PDBe:5zc9, PDBj:5zc9
PDBsum	5zc9
PubMed	30595437
UniProt	P60842\|IF4A1_HUMAN Eukaryotic initiation factor 4A-I (Gene Name=EIF4A1)

[Back to BioLiP]