Structure of PDB 5zb0 Chain A

Receptor sequence
>5zb0A (length=187) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLL
LTQELSPEAEYLLFSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQG
YGRGLPLPWLREVAREATRGLKPRLTFLLDLPPEAALEGLGLEFFRRVRE
GYLALARAEPGRFVVLDATLPEEEIARAIQAHLRPLL
3D structure
PDB5zb0 Insights into product release dynamics through structural analyses of thymidylate kinase.
ChainA
Resolution1.19 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.4.9: dTMP kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 TYD A D12 R38 E39 P40 R48 F65 R69 R91 S95 S96 Y99 Q100 D11 R37 E38 P39 R47 F64 R68 R90 S94 S95 Y98 Q99
BS02 ADP A G13 S14 G15 K16 T17 T18 E182 G12 S13 G14 K15 T16 T17 E172
BS03 MG A T7 E9 D94 T6 E8 D93
BS04 MG A P40 F65 D68 P39 F64 D67
BS05 MG A Y62 S66 R69 Y61 S65 R68
Gene Ontology
Molecular Function
GO:0004798 thymidylate kinase activity
GO:0005524 ATP binding
GO:0016301 kinase activity
Biological Process
GO:0006227 dUDP biosynthetic process
GO:0006233 dTDP biosynthetic process
GO:0006235 dTTP biosynthetic process
GO:0009165 nucleotide biosynthetic process
GO:0016310 phosphorylation
GO:0046940 nucleoside monophosphate phosphorylation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zb0, PDBe:5zb0, PDBj:5zb0
PDBsum5zb0
PubMed30447376
UniProtQ5SHX3|KTHY_THET8 Thymidylate kinase (Gene Name=tmk)

[Back to BioLiP]