Structure of PDB 5z62 Chain A

Receptor sequence

>5z62A (length=513) Species: 9606 (Homo sapiens) [Search protein sequence]

MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGN
DHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNM
SFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSL
HLAGVSSILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLP
VLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPG
FGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVD
TRAYFTSATMIIAIPTGVKVFSWLATLHGSNMKWSAAVLWALGFIFLFTV
GGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLF
SGYTLDQTYAKIHFTIMFIGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTW
NILSSVGSFISLTAVMLMIFMIWEAFASKRKVLMVEEPSMNLEWLYGCPP
PYHTFEEPVYMKS

3D structure

PDB

5z62 Structure of the intact 14-subunit human cytochrome c oxidase.

Chain

Resolution

3.6 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H61 D91 W126 S156 S157 H240 E242 Y244 S255 H290 H291 T316 K319 R438
Catalytic site (residue number reindexed from 1)	H61 D91 W126 S156 S157 H240 E242 Y244 S255 H290 H291 T316 K319 R438
Enzyme Commision number	7.1.1.9: cytochrome-c oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CU	A	H240 H290 H291	H240 H290 H291
BS02	MG	A	H368 D369	H368 D369
BS03	HEA	A	G27 T31 S34 R38 Y54 V58 H61 A62 M65 M69 Y371 F377 H378 L381 V386 M390 F425 R438 R439 M468	G27 T31 S34 R38 Y54 V58 H61 A62 M65 M69 Y371 F377 H378 L381 V386 M390 F425 R438 R439 M468
BS04	HEA	A	W236 V243 H290 H291 I312 T349 G352 L353 G355 L358 A359 H368 V373 H376 F377 V380 L381 R438	W236 V243 H290 H291 I312 T349 G352 L353 G355 L358 A359 H368 V373 H376 F377 V380 L381 R438

Gene Ontology

	Molecular Function
GO:0004129	cytochrome-c oxidase activity
GO:0005515	protein binding
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0001666	response to hypoxia
GO:0006119	oxidative phosphorylation
GO:0006123	mitochondrial electron transport, cytochrome c to oxygen
GO:0006979	response to oxidative stress
GO:0009060	aerobic respiration
GO:0015990	electron transport coupled proton transport
GO:0021549	cerebellum development
GO:0045333	cellular respiration
GO:0046688	response to copper ion
GO:0051602	response to electrical stimulus

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0016020	membrane
GO:0031966	mitochondrial membrane
GO:0045277	respiratory chain complex IV

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5z62, PDBe:5z62, PDBj:5z62
PDBsum	5z62
PubMed	30030519
UniProt	P00395\|COX1_HUMAN Cytochrome c oxidase subunit 1 (Gene Name=MT-CO1)

[Back to BioLiP]