Structure of PDB 5z41 Chain A

Receptor sequence
>5z41A (length=99) Species: 224324 (Aquifex aeolicus VF5) [Search protein sequence]
TYEILGQMDETFILVKDSEYLYFVDQHLLEERINYEKLKDENLACRISVK
AGQKLSEEKIRELIKTWRNLENPHVCPHGRPIYYKIPLREIYEKVGRNY
3D structure
PDB5z41 Multiple zinc ions maintain the open conformation of the catalytic site in the DNA mismatch repair endonuclease MutL from Aquifex aeolicus
ChainA
Resolution1.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A E34 C48 C79 H81 E31 C45 C76 H78
BS02 MG A N75 H77 N72 H74
Gene Ontology
Molecular Function
GO:0005524 ATP binding
GO:0016887 ATP hydrolysis activity
GO:0140664 ATP-dependent DNA damage sensor activity
Biological Process
GO:0006298 mismatch repair
Cellular Component
GO:0032300 mismatch repair complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5z41, PDBe:5z41, PDBj:5z41
PDBsum5z41
PubMed29645090
UniProtO67518|MUTL_AQUAE DNA mismatch repair protein MutL (Gene Name=mutL)

[Back to BioLiP]