Structure of PDB 5z23 Chain A

Receptor sequence
>5z23A (length=99) Species: 9606 (Homo sapiens) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREICVKFTRGVDFNWQ
AQALLALQEAAEAFLVHLFEDAYLLTLHAKRVTIMPKDIQLARRIRGER
3D structure
PDB5z23 The CENP-A centromere targeting domain facilitates H4K20 monomethylation in the nucleosome by structural polymorphism.
ChainA
Resolution2.73 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y41 R42 P43 T45 R63 R72 N85 W86 Q87 V119 T120 Y4 R5 P6 T8 R26 R35 N48 W49 Q50 V82 T83
BS02 dna A H39 R40 Y41 P43 G44 V46 R49 R63 K64 L65 R69 H2 R3 Y4 P6 G7 V9 R12 R26 K27 L28 R32
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5z23, PDBe:5z23, PDBj:5z23
PDBsum5z23
PubMed30718488
UniProtP49450|CENPA_HUMAN Histone H3-like centromeric protein A (Gene Name=CENPA);
P68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]