Structure of PDB 5yxu Chain A

Receptor sequence

>5yxuA (length=191) Species: 9606 (Homo sapiens)

AQTVTQSQPEMSVQEAETVTLSCTYDTSENDYILFWYKQPPSRQMILVIR
QEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAYGEDDKI
IFGKGTRLHILPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSK
DSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNN

3D structure

• PDB: 5yxu an affinity enhanced T cell receptor in complex with HLA-A0201 restricted HCV NS3 peptide KLVALGINAV
• Chain: A
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	S29 E97 D98	S28 E96 D97

External links

• PDB: RCSB:5yxu, PDBe:5yxu, PDBj:5yxu
• PDBsum: 5yxu