Structure of PDB 5yve Chain A

Receptor sequence
>5yveA (length=327) Species: 9606 (Homo sapiens) [Search protein sequence]
WTIGIINRVVQLLIISYFVGWVFLHEKAYQVRDTAIESSVVTKVKGSGLY
ANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDS
QCGPERLPGGGILTGRCVNYSSVLRTCEIQGWCPTEVDTVETPIMMEAEN
FTIFIKNSIRFPLFNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGD
VVKFAGQDFAKLARTGGVLGIKIGWVCDLDKAWDQCIPKYSFTRLDSVSE
KSSVSPGYNFRFAKYYKMENGSEYRTLLKAFGIRFDVLVYGNAGKFNIIP
TIISSVAAFTSVGVGTVLCDIILLNFL
3D structure
PDB5yve Druggable negative allosteric site of P2X3 receptors.
ChainA
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG A E111 D158 E91 D138
BS02 AF9 A L265 D266 L245 D246 PDBbind-CN: -logKd/Ki=6.48,IC50=0.33uM
BindingDB: IC50=45nM
Gene Ontology
Molecular Function
GO:0001614 purinergic nucleotide receptor activity
GO:0004931 extracellularly ATP-gated monoatomic cation channel activity
GO:0005216 monoatomic ion channel activity
GO:0005524 ATP binding
GO:0015267 channel activity
Biological Process
GO:0001666 response to hypoxia
GO:0006811 monoatomic ion transport
GO:0006812 monoatomic cation transport
GO:0007165 signal transduction
GO:0007268 chemical synaptic transmission
GO:0007274 neuromuscular synaptic transmission
GO:0009266 response to temperature stimulus
GO:0009408 response to heat
GO:0009409 response to cold
GO:0009612 response to mechanical stimulus
GO:0009743 response to carbohydrate
GO:0010524 positive regulation of calcium ion transport into cytosol
GO:0014832 urinary bladder smooth muscle contraction
GO:0030432 peristalsis
GO:0033198 response to ATP
GO:0034220 monoatomic ion transmembrane transport
GO:0035590 purinergic nucleotide receptor signaling pathway
GO:0048167 regulation of synaptic plasticity
GO:0048266 behavioral response to pain
GO:0050804 modulation of chemical synaptic transmission
GO:0050850 positive regulation of calcium-mediated signaling
GO:0050909 sensory perception of taste
GO:0051649 establishment of localization in cell
GO:0060079 excitatory postsynaptic potential
GO:0070207 protein homotrimerization
GO:0070588 calcium ion transmembrane transport
GO:0071318 cellular response to ATP
GO:0098655 monoatomic cation transmembrane transport
GO:0098662 inorganic cation transmembrane transport
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030424 axon
GO:0043005 neuron projection
GO:0043235 receptor complex
GO:0098685 Schaffer collateral - CA1 synapse
GO:0098686 hippocampal mossy fiber to CA3 synapse
GO:0098794 postsynapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5yve, PDBe:5yve, PDBj:5yve
PDBsum5yve
PubMed29674445
UniProtP56373|P2RX3_HUMAN P2X purinoceptor 3 (Gene Name=P2RX3)

[Back to BioLiP]