Structure of PDB 5yq7 Chain A

Receptor sequence
>5yq7A (length=36) Species: 120962 (Roseiflexus castenholzii) [Search protein sequence]
PFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLR
3D structure
PDB5yq7 Cryo-EM structure of the RC-LH core complex from an early branching photosynthetic prokaryote.
ChainA
Resolution4.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL A A23 H27 F36 A19 H23 F32
BS02 KGD A L24 H27 L20 H23
BS03 BCL A T16 L20 H27 W38 T12 L16 H23 W34
BS04 KGD A T16 L18 G19 M22 I26 T12 L14 G15 M18 I22
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5yq7, PDBe:5yq7, PDBj:5yq7
PDBsum5yq7
PubMed29674684
UniProtQ83XD1

[Back to BioLiP]