Structure of PDB 5ypw Chain A

Receptor sequence

>5ypwA (length=90) Species: 83334 (Escherichia coli O157:H7)

DNVILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQDSDKSHIWLLV
NDDQRLEQMISQIDKLEDVVKVQRNQSDPTMFNKIAVFFQ

3D structure

• PDB: 5ypw Crystallographic Structures of IlvN·Val/Ile Complexes: Conformational Selectivity for Feedback Inhibition of Aceto Hydroxy Acid Synthases.
• Chain: A
• Resolution: 2.3 Å

Enzymatic activity

• Enzyme Commision number: 2.2.1.6: acetolactate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	VAL	A	H20 G22 V23 M24 C43	H12 G14 V15 M16 C35	PDBbind-CN: -logKd/Ki=4.64,Kd~23uM
BS02	VAL	A	N37 V38	N29 V30	PDBbind-CN: -logKd/Ki=4.64,Kd~23uM

Gene Ontology

Molecular Function

• GO:0003984 acetolactate synthase activity
• GO:0005515 protein binding
• GO:0016740 transferase activity
• GO:1990610 acetolactate synthase regulator activity

Biological Process

• GO:0008652 amino acid biosynthetic process
• GO:0009082 branched-chain amino acid biosynthetic process
• GO:0009097 isoleucine biosynthetic process
• GO:0009099 L-valine biosynthetic process

Cellular Component

• GO:0005829 cytosol
• GO:0005948 acetolactate synthase complex

External links

• PDB: RCSB:5ypw, PDBe:5ypw, PDBj:5ypw
• PDBsum: 5ypw
• PubMed: 30887800
• UniProt: P0ADF8|ILVN_ECOLI Acetolactate synthase isozyme 1 small subunit (Gene Name=ilvN)