Structure of PDB 5yir Chain A

Receptor sequence
>5yirA (length=117) Species: 10090 (Mus musculus) [Search protein sequence]
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYL
VPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHE
EDFFLYIAYSDESVYGL
3D structure
PDB5yir Potent and specific Atg8-targeting autophagy inhibitory peptides from giant ankyrins.
ChainA
Resolution2.75 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A H9 E17 Y25 P30 K48 Y49 L50 P52 D54 Q59 F62 L63 K66 R67 F104 H9 E17 Y25 P30 K48 Y49 L50 P52 D54 Q59 F62 L63 K66 R67 F104
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008017 microtubule binding
GO:0008429 phosphatidylethanolamine binding
GO:0031625 ubiquitin protein ligase binding
GO:0048487 beta-tubulin binding
GO:0050811 GABA receptor binding
Biological Process
GO:0000226 microtubule cytoskeleton organization
GO:0006914 autophagy
GO:0006915 apoptotic process
GO:0008625 extrinsic apoptotic signaling pathway via death domain receptors
GO:0015031 protein transport
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0035020 regulation of Rac protein signal transduction
GO:0098696 regulation of neurotransmitter receptor localization to postsynaptic specialization membrane
GO:1902524 positive regulation of protein K48-linked ubiquitination
Cellular Component
GO:0000139 Golgi membrane
GO:0000421 autophagosome membrane
GO:0005737 cytoplasm
GO:0005764 lysosome
GO:0005776 autophagosome
GO:0005790 smooth endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0005875 microtubule associated complex
GO:0005886 plasma membrane
GO:0005930 axoneme
GO:0012505 endomembrane system
GO:0015629 actin cytoskeleton
GO:0016020 membrane
GO:0031410 cytoplasmic vesicle
GO:0097225 sperm midpiece
GO:0098982 GABA-ergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5yir, PDBe:5yir, PDBj:5yir
PDBsum5yir
PubMed29867141
UniProtQ9DCD6|GBRAP_MOUSE Gamma-aminobutyric acid receptor-associated protein (Gene Name=Gabarap)

[Back to BioLiP]