Structure of PDB 5yiq Chain A

Receptor sequence
>5yiqA (length=115) Species: 10090 (Mus musculus) [Search protein sequence]
KTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLV
PDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERD
EDGFLYMVYASQETF
3D structure
PDB5yiq Potent and specific Atg8-targeting autophagy inhibitory peptides from giant ankyrins.
ChainA
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A I23 H27 K49 K51 F52 L53 E62 I66 R70 I19 H23 K45 K47 F48 L49 E58 I62 R66
BS02 ZN A H86 E102 H82 E98
BS03 ZN A E97 E100 E93 E96
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0000423 mitophagy
GO:0006914 autophagy
GO:0009267 cellular response to starvation
GO:0051649 establishment of localization in cell
GO:0070254 mucus secretion
GO:0070257 positive regulation of mucus secretion
Cellular Component
GO:0000421 autophagosome membrane
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005776 autophagosome
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0005930 axoneme
GO:0012505 endomembrane system
GO:0016020 membrane
GO:0031410 cytoplasmic vesicle
GO:0031966 mitochondrial membrane
GO:0044754 autolysosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5yiq, PDBe:5yiq, PDBj:5yiq
PDBsum5yiq
PubMed29867141
UniProtQ9CQV6|MLP3B_MOUSE Microtubule-associated proteins 1A/1B light chain 3B (Gene Name=Map1lc3b)

[Back to BioLiP]