Structure of PDB 5yhy Chain A |
>5yhyA (length=146) Species: 272623 (Lactococcus lactis subsp. lactis Il1403) [Search protein sequence] |
GMSLANQIDQFLGTIMQFAENKHEILLGKSESDVKLTSTQEHILMLLAEQ ISTNAKIAEKLKISPAAVTKALKKLQEQELIKSSRATNDERVVLWSLTEK AVPVAKEHATHHEKTLSTYQELGNKFTDEEQEVISKFLSALTEEFQ |
|
PDB | 5yhy Allosteric histidine switch for regulation of intracellular zinc(II) fluctuation. |
Chain | A |
Resolution | 1.65 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
E24 H42 H108 H112 |
E24 H42 H108 H112 |
|
|
|
|