Structure of PDB 5yef Chain A

Receptor sequence

>5yefA (length=169) Species: 9606 (Homo sapiens) [Search protein sequence]

PHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYASVEVSKLKRHI
RSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSG
TMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCR
YCDAVFHERYALIQHQKSH

3D structure

PDB

5yef Molecular mechanism of directional CTCF recognition of a diverse range of genomic sites

Chain

Resolution

2.807 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	Y392 K395	Y72 K75
BS02	dna	A	R339 H340 Y343 K344 K365 R368 H369 S372 R377 Y386 R389 R396 H397 T400 Q418 T421 K429 I446 R448 D451 H455	R19 H20 Y23 K24 K45 R48 H49 S52 R57 Y66 R69 R76 H77 T80 Q98 T101 K109 I126 R128 D131 H135
BS03	ZN	A	C327 H340 H345	C7 H20 H25
BS04	ZN	A	C353 H369 H373	C33 H49 H53
BS05	ZN	A	C381 C384 H397 H401	C61 C64 H77 H81
BS06	ZN	A	C409 C412 H425 H430	C89 C92 H105 H110
BS07	ZN	A	C439 C442 H455 H460	C119 C122 H135 H140
BS08	ZN	A	C469 C472 H485 H489	C149 C152 H165 H169

External links

PDB	RCSB:5yef, PDBe:5yef, PDBj:5yef
PDBsum	5yef
PubMed	29076501
UniProt	P49711\|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]