Structure of PDB 5yc3 Chain A

Receptor sequence
>5yc3A (length=60) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
GPLGSDHGETLCGACGDSDGADEFWICCDLCEKWFHGKCVKITPARAEHI
KQYKCPSCSN
3D structure
PDB5yc3 Systematic Profiling of Histone Readers in Arabidopsis thaliana.
ChainA
Resolution2.601 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A T5 G15 A16 D17 E18 F19 W20 I21 C22 W29 I45 K46 T10 G20 A21 D22 E23 F24 W25 I26 C27 W34 I50 K51
BS02 ZN A C7 C10 H31 C34 C12 C15 H36 C39
BS03 ZN A C23 C26 C50 C53 C28 C31 C55 C58
Gene Ontology
Molecular Function
GO:0042393 histone binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5yc3, PDBe:5yc3, PDBj:5yc3
PDBsum5yc3
PubMed29386129
UniProtQ9M2B4|ALFL3_ARATH PHD finger protein ALFIN-LIKE 3 (Gene Name=AL3)

[Back to BioLiP]