Structure of PDB 5ybd Chain A

Receptor sequence
>5ybdA (length=96) Species: 9606 (Homo sapiens) [Search protein sequence]
IQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNM
NYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALLEHHHHH
3D structure
PDB5ybd Comparative structure analysis of the ETSi domain of ERG3 and its complex with the E74 promoter DNA sequence
ChainA
Resolution2.769 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y362 R367 R370 Y371 Y373 K380 R385 Y386 Y52 R57 R60 Y61 Y63 K70 R75 Y76
BS02 dna A Q312 W351 K355 K357 M360 D363 K364 Y371 Y372 Q2 W41 K45 K47 M50 D53 K54 Y61 Y62
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5ybd, PDBe:5ybd, PDBj:5ybd
PDBsum5ybd
PubMed30279318
UniProtP11308|ERG_HUMAN Transcriptional regulator ERG (Gene Name=ERG)

[Back to BioLiP]