Structure of PDB 5yao Chain A |
>5yaoA (length=146) Species: 1833 (Rhodococcus erythropolis) [Search protein sequence] |
KIEQPRWASKDSAAGAASTPDEKIVLEFVDALTSNDAAKLIEYFAEDTMY QNMPLPPAYGRDAVEQTLAGLFTVVSVDAVETFHIGSSNGLVYTERVDVL RALPTGKSYNFSILGVFQLTEGKITGWRDYFDLREFEEAVDLPLRG |
|
PDB | 5yao Structural and Computational Insight into the Catalytic Mechanism of Limonene Epoxide Hydrolase Mutants in Stereoselective Transformations |
Chain | A |
Resolution | 2.611 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
3ZS |
A |
Y53 N55 F139 |
Y50 N52 F136 |
|
|
|
|