Structure of PDB 5y86 Chain A

Receptor sequence
>5y86A (length=395) Species: 9606 (Homo sapiens) [Search protein sequence]
VVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNN
GGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVAL
KMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMA
FELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLK
PENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYS
TPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSK
RAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTAL
KGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTT
3D structure
PDB5y86 Crystal Structure of Human Dual-Specificity Tyrosine-Regulated Kinase 3 Reveals New Structural Features and Insights into its Auto-phosphorylation
ChainA
Resolution1.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D335 K337 N340 D355 S372
Catalytic site (residue number reindexed from 1) D198 K200 N203 D218 S235
Enzyme Commision number 2.7.12.1: dual-specificity kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HRM A A236 K238 F288 L291 L342 I354 A99 K101 F151 L154 L205 I217 MOAD: ic50=0.8uM
PDBbind-CN: -logKd/Ki=6.10,IC50=0.8uM
BindingDB: IC50=800nM
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004712 protein serine/threonine/tyrosine kinase activity
GO:0004713 protein tyrosine kinase activity
GO:0005524 ATP binding
GO:0046872 metal ion binding
GO:0106310 protein serine kinase activity
Biological Process
GO:0006468 protein phosphorylation
GO:0016310 phosphorylation
GO:0030218 erythrocyte differentiation
GO:0035063 nuclear speck organization
GO:0035617 stress granule disassembly
GO:0043066 negative regulation of apoptotic process
GO:0043518 negative regulation of DNA damage response, signal transduction by p53 class mediator
GO:0051301 cell division
GO:0080135 regulation of cellular response to stress
GO:1902751 positive regulation of cell cycle G2/M phase transition
GO:1903008 organelle disassembly
GO:1903432 regulation of TORC1 signaling
Cellular Component
GO:0000242 pericentriolar material
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0010494 cytoplasmic stress granule
GO:0016607 nuclear speck
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5y86, PDBe:5y86, PDBj:5y86
PDBsum5y86
PubMed29634919
UniProtO43781|DYRK3_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 3 (Gene Name=DYRK3)

[Back to BioLiP]