Structure of PDB 5xzr Chain A

Receptor sequence
>5xzrA (length=519) Species: 9606 (Homo sapiens) [Search protein sequence]
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGA
VTHIKIQNTGDYYDLYGGEKFATLAALVQYYMEHHGQLKEKNGDVIELKY
PLNCADPTSERWFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLS
VRTGDDKGESNDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHYKKN
PMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAEKVKQGFWEEFET
LQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEPVSD
YINANIIMPKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEVERGKS
KCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQGNTERTV
WQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGR
TGTFIVIDILIDIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIY
MAVQHYIETLQRRIEEEQK
3D structure
PDB5xzr Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
ChainA
Resolution2.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) V25 G49 L436 S502 V505
Catalytic site (residue number reindexed from 1) V25 G49 L421 S487 V490
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 8J6 A E110 R111 F113 H114 N217 T218 E250 T253 P491 K492 E110 R111 F113 H114 N217 T218 E247 T250 P476 K477 PDBbind-CN: -logKd/Ki=5.49,IC50=3.27uM
Gene Ontology
Molecular Function
GO:0001784 phosphotyrosine residue binding
GO:0004721 phosphoprotein phosphatase activity
GO:0004725 protein tyrosine phosphatase activity
GO:0004726 non-membrane spanning protein tyrosine phosphatase activity
GO:0005158 insulin receptor binding
GO:0005515 protein binding
GO:0019901 protein kinase binding
GO:0030159 signaling receptor complex adaptor activity
GO:0030971 receptor tyrosine kinase binding
GO:0045296 cadherin binding
GO:0050839 cell adhesion molecule binding
GO:0051428 peptide hormone receptor binding
GO:0060090 molecular adaptor activity
GO:1990782 protein tyrosine kinase binding
Biological Process
GO:0000077 DNA damage checkpoint signaling
GO:0006470 protein dephosphorylation
GO:0006629 lipid metabolic process
GO:0006641 triglyceride metabolic process
GO:0007165 signal transduction
GO:0007173 epidermal growth factor receptor signaling pathway
GO:0007229 integrin-mediated signaling pathway
GO:0007409 axonogenesis
GO:0007420 brain development
GO:0007507 heart development
GO:0008543 fibroblast growth factor receptor signaling pathway
GO:0009755 hormone-mediated signaling pathway
GO:0009967 positive regulation of signal transduction
GO:0016311 dephosphorylation
GO:0019221 cytokine-mediated signaling pathway
GO:0021697 cerebellar cortex formation
GO:0030220 platelet formation
GO:0031295 T cell costimulation
GO:0032331 negative regulation of chondrocyte differentiation
GO:0032480 negative regulation of type I interferon production
GO:0032528 microvillus organization
GO:0032728 positive regulation of interferon-beta production
GO:0032755 positive regulation of interleukin-6 production
GO:0032760 positive regulation of tumor necrosis factor production
GO:0033628 regulation of cell adhesion mediated by integrin
GO:0033629 negative regulation of cell adhesion mediated by integrin
GO:0035264 multicellular organism growth
GO:0035265 organ growth
GO:0035335 peptidyl-tyrosine dephosphorylation
GO:0035855 megakaryocyte development
GO:0036302 atrioventricular canal development
GO:0038127 ERBB signaling pathway
GO:0042445 hormone metabolic process
GO:0042593 glucose homeostasis
GO:0043254 regulation of protein-containing complex assembly
GO:0043408 regulation of MAPK cascade
GO:0045778 positive regulation of ossification
GO:0045931 positive regulation of mitotic cell cycle
GO:0046326 positive regulation of D-glucose import
GO:0046628 positive regulation of insulin receptor signaling pathway
GO:0046676 negative regulation of insulin secretion
GO:0046825 regulation of protein export from nucleus
GO:0046887 positive regulation of hormone secretion
GO:0046888 negative regulation of hormone secretion
GO:0048008 platelet-derived growth factor receptor signaling pathway
GO:0048011 neurotrophin TRK receptor signaling pathway
GO:0048013 ephrin receptor signaling pathway
GO:0048806 genitalia development
GO:0048839 inner ear development
GO:0048873 homeostasis of number of cells within a tissue
GO:0050731 positive regulation of peptidyl-tyrosine phosphorylation
GO:0051463 negative regulation of cortisol secretion
GO:0060020 Bergmann glial cell differentiation
GO:0060125 negative regulation of growth hormone secretion
GO:0060325 face morphogenesis
GO:0060338 regulation of type I interferon-mediated signaling pathway
GO:0061582 intestinal epithelial cell migration
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0071364 cellular response to epidermal growth factor stimulus
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5xzr, PDBe:5xzr, PDBj:5xzr
PDBsum5xzr
PubMed29155585
UniProtQ06124|PTN11_HUMAN Tyrosine-protein phosphatase non-receptor type 11 (Gene Name=PTPN11)

[Back to BioLiP]