Structure of PDB 5xyf Chain A

Receptor sequence

>5xyfA (length=192) Species: 9606 (Homo sapiens) [Search protein sequence]

LVAGPAALRFAAAASWQVVRGRCVEHFPRVLEFLRSLRAVAPGLVRYRHH
ERLCMGLKAKVVVELILQGRPWAQVLKALNHHFPESGRDPKATKQDLRKI
LEAQETFYQQVKQLSEAPVDLASKLQELEQEYGEPFLAAMEKLLFEYLCQ
LEKALPTPQAQQLQDVLSWMQPGVSITSSLAWRQYGVDMGWL

3D structure

PDB

5xyf Structural and functional analyses of the mammalian TIN2-TPP1-TRF2 telomeric complex.

Chain

Resolution

2.202 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	R52 R56 K106 E109 A110 T113 F114 E138 Y139 P142 F143	R48 R52 K99 E102 A103 T106 F107 E131 Y132 P135 F136
BS02	peptide	A	A11 L12 F14 A18 Q21 V22 H30 R33 F37 S40 V44 A45 A161 L162 P163 M177 S186	A7 L8 F10 A14 Q17 V18 H26 R29 F33 S36 V40 A41 A154 L155 P156 M170 S179

Gene Ontology

	Biological Process
GO:0016233	telomere capping

	Cellular Component
GO:0070187	shelterin complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5xyf, PDBe:5xyf, PDBj:5xyf
PDBsum	5xyf
PubMed	29160297
UniProt	Q9BSI4\|TINF2_HUMAN TERF1-interacting nuclear factor 2 (Gene Name=TINF2)

[Back to BioLiP]