Structure of PDB 5xro Chain A

Receptor sequence
>5xroA (length=141) Species: 9606 (Homo sapiens) [Search protein sequence]
SLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIV
FHFQVCFGRRVVMNSREYGAWKAQVESKNMPFQDGQEFELSISVLPDKYQ
VMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR
3D structure
PDB5xro Galectin-10: a new structural type of prototype galectin dimer and effects on saccharide ligand binding.
ChainA
Resolution1.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GOL A H53 N65 W72 Q75 H52 N64 W71 Q74
Gene Ontology
Molecular Function
GO:0004622 lysophospholipase activity
GO:0005515 protein binding
GO:0030246 carbohydrate binding
GO:0042802 identical protein binding
GO:0097153 cysteine-type endopeptidase activity involved in apoptotic process
Biological Process
GO:0002667 regulation of T cell anergy
GO:0002724 regulation of T cell cytokine production
GO:0046006 regulation of activated T cell proliferation
GO:0070231 T cell apoptotic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0062023 collagen-containing extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5xro, PDBe:5xro, PDBj:5xro
PDBsum5xro
PubMed29293962
UniProtQ05315|LEG10_HUMAN Galectin-10 (Gene Name=CLC)

[Back to BioLiP]