Structure of PDB 5xoj Chain A

Receptor sequence

>5xojA (length=170) Species: 764097 (Saccharomyces cerevisiae AWRI796)

VPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFG
EIKFDVWDTAGLEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRD
LVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNF
EKPFLWLARKLAGNPQLEFV

3D structure

• PDB: 5xoj Crystal structure of the Xpo1p nuclear export complex bound to the SxFG/PxFG repeats of the nucleoporin Nup42p
• Chain: A
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	A	G21 G22 T23 G24 K25 T26 T27 F37 E38 K39 K40 Y41 A43 T44 G70 N124 K125 D127 S152 K154	G12 G13 T14 G15 K16 T17 T18 F28 E29 K30 K31 Y32 A34 T35 G61 N115 K116 D118 S143 K145
BS02	MG	A	T26 T44	T17 T35

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Dec 2 21:29:16 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5xoj', asym_id = 'A', title = 'Crystal structure of the Xpo1p nuclear export co...o the SxFG/PxFG repeats of the nucleoporin Nup42p'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5xoj', asym_id='A', title='Crystal structure of the Xpo1p nuclear export co...o the SxFG/PxFG repeats of the nucleoporin Nup42p')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003924,0005525,0006913', uniprot = '', pdbid = '5xoj', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003924,0005525,0006913', uniprot='', pdbid='5xoj', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>