Structure of PDB 5xmz Chain A |
>5xmzA (length=122) Species: 27337 (Verticillium dahliae) [Search protein sequence] |
DPNMYENIDIADFNVRKGEDGTIKYVNFKLSGDDADGLLCEAQNPGLPSN VITCGESKYRFALSSGKQYEFALSLYHELGLAVGFYGTGEIFTHCRAGGL GDFICQQQNPTTIVIDSLPDAP |
|
PDB | 5xmz The asparagine-rich protein NRP interacts with the Verticillium effector PevD1 and regulates the subcellular localization of cryptochrome 2 |
Chain | A |
Resolution | 1.85 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
Y116 D146 L148 |
Y86 D116 L118 |
|
|
|