Structure of PDB 5xmo Chain A |
>5xmoA (length=124) Species: 223 (Achromobacter cycloclastes) [Search protein sequence] |
ADFEVHMLNKGKDGAFVFEPASLKVAPGDTVTFIPKDKGHNVETIKGMIP DGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLE AVKGAKNPKKAQERLDAALAALGN |
|
PDB | 5xmo X-ray Crystallographic Analysis of M16F/T36K Double Mutant of Pseudoazurin |
Chain | A |
Resolution | 1.19 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H40 C78 H81 |
H40 C78 H81 |
|
|
|
|