Structure of PDB 5xkt Chain A

Receptor sequence

>5xktA (length=199) Species: 861365 (Klebsiella pneumoniae subsp. rhinoscleromatis SB3432)

HPLRVGVGGPVGSGKTALLEALCKAMRDTWQLAVVTNDIYTKEDQRILTE
AGTLAPERIVGVETGGCPHTAIREDASMNLAAVEALSEKFGNLDLIFVES
GGDNLSATFSPELADLTIYVIDVAEGEKIPRKGGPGITRSDFLVINKTDL
APYVGASLKVMASDTQRMRGDRPWTFTNLKQGDGLSTIIAFLEDKGMLG

3D structure

• PDB: 5xkt Structural insights into how GTP-dependent conformational changes in a metallochaperone UreG facilitate urease maturation.
• Chain: A
• Resolution: 1.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GNP	A	V16 G17 G19 K20 T21 A22 E104 N151 K152 D154 N183 K185	V11 G12 G14 K15 T16 A17 E99 N146 K147 D149 N178 K180
BS02	NI	A	T21 D49 E104	T16 D44 E99
BS03	NI	A	C72 H74	C67 H69
BS04	GNP	A	E130 K133 K137 V159	E125 K128 K132 V154

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Nov 28 23:04:54 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5xkt', asym_id = 'A', title = 'Structural insights into how GTP-dependent confo...tallochaperone UreG facilitate urease maturation.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5xkt', asym_id='A', title='Structural insights into how GTP-dependent confo...tallochaperone UreG facilitate urease maturation.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003924,0016151,0043419', uniprot = '', pdbid = '5xkt', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003924,0016151,0043419', uniprot='', pdbid='5xkt', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>