Structure of PDB 5xj9 Chain A

Receptor sequence

>5xj9A (length=200) Species: 224324 (Aquifex aeolicus VF5)

GSALFLVIFAYLLGSITFGEVIAKLKGVDLRNVGSGNVGATNVTRALGKK
YGVLVFFLDFLKGFIPALIAVKSFGIDSWVLTFTGLASVLGHMYPVFFGF
KGGKGVATALGVVFAVSPSVALFSFLVWLGIFLWKRYVSLASITATISAF
LFLFVAGYPVNVLFMAIVIGALIIYRHRENINRLLTGREHRFGTLEVLFQ

3D structure

• PDB: 5xj9 Structural insights into the committed step of bacterial phospholipid biosynthesis.
• Chain: A
• Resolution: 1.83 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.275: acyl phosphate:glycerol-3-phosphate acyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PO4	A	K135 R136 R191	K135 R136 R191
BS02	PO4	A	H92 G103 K104 G105 V106	H92 G103 K104 G105 V106
BS03	PO4	A	N37 G39 T41 N42 K104	N37 G39 T41 N42 K104
BS04	PO4	A	S35 R45 K104	S35 R45 K104
BS05	PO4	A	K26 Y51	K26 Y51
BS06	78M	A	T41 F56 V106 A107 A109 S124 W128 A145 A166	T41 F56 V106 A107 A109 S124 W128 A145 A166
BS07	78M	A	K49 F132 V138 F192	K49 F132 V138 F192
BS08	78M	A	A40 T44 K49 F56 L122 F125	A40 T44 K49 F56 L122 F125
BS09	78M	A	K135 L140 I143 T144	K135 L140 I143 T144
BS10	78M	A	F9 I65 I69 K72 S73	F9 I65 I69 K72 S73
BS11	78M	A	A3 L4 V80 F83	A3 L4 V80 F83
BS12	78M	A	A171 L172 I174 Y175	A171 L172 I174 Y175
BS13	78M	A	Y11 A87 Y94	Y11 A87 Y94

Gene Ontology

Molecular Function

• GO:0016740 transferase activity
• GO:0043772 acyl-phosphate glycerol-3-phosphate acyltransferase activity

Biological Process

• GO:0006644 phospholipid metabolic process
• GO:0008654 phospholipid biosynthetic process

Cellular Component

• GO:0005886 plasma membrane

External links

• PDB: RCSB:5xj9, PDBe:5xj9, PDBj:5xj9
• PDBsum: 5xj9
• PubMed: 29167463
• UniProt: O66905|PLSY_AQUAE Glycerol-3-phosphate acyltransferase (Gene Name=plsY)