Structure of PDB 5xem Chain A

Receptor sequence

>5xemA (length=302) Species: 190304 (Fusobacterium nucleatum subsp. nucleatum ATCC 25586)

SLANSVIDLIGNTPLVKINNIDTFGNEIYVKLEGSNPGRSTKDRIALKMI
EEAEKEGLIDKDTVIIEATSGNTGIGLAMICAVKNYKLKIVMPDTMSIER
IQLMRAYGTEVILTDGSLGMKACLEKLEELKKNEKKYFVPNQFTNVNNPK
AHYETTAEEILKDLNNKVDVFICGTGTGGSFSGTAKKLKEKLPNIKTFPV
EPASSPLLSKGYIGPHKIQGMGMSIGGIPAVYDGSLADDILVCEDDDAFE
MMRELSFKEGILGGISTGATFKAALDYSKENADKGLKIVVLSTDSGEKYL
SN

3D structure

• PDB: 5xem Purification, crystallization and preliminary X-ray analysis of two hydrogen sulfide-producing enzymes from Fusobacterium nucleatum.
• Chain: A
• Resolution: 1.84 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.47: cysteine synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	85F	A	K42 T69 S70 N72 T73 M120 Q142 G176 T177 G220 M221 G222 S224	K42 T69 S70 N72 T73 M120 Q142 G176 T177 G220 M221 G222 S224
BS02	PLP	A	K42 N72 T175 G176 T177 G178 S180 G220 S266 T293 D294	K42 N72 T175 G176 T177 G178 S180 G220 S266 T293 D294
BS03	CA	A	L300 S301 N302	L300 S301 N302

Gene Ontology

Molecular Function

• GO:0004124 cysteine synthase activity
• GO:0016740 transferase activity
• GO:0046872 metal ion binding
• GO:0080146 L-cysteine desulfhydrase activity

Biological Process

• GO:0006534 cysteine metabolic process
• GO:0006535 cysteine biosynthetic process from serine
• GO:0009069 serine family amino acid metabolic process
• GO:0044272 sulfur compound biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5xem, PDBe:5xem, PDBj:5xem
• PDBsum: 5xem
• UniProt: Q8RE94