Structure of PDB 5xdq Chain A

Receptor sequence

>5xdqA (length=514) Species: 9913 (Bos taurus) [Search protein sequence]

MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGD
DQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNM
SFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSL
HLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLP
VLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPG
FGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVD
TRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTV
GGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLF
SGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMW
NTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPP
PYHTFEEPTYVNLK

3D structure

PDB

5xdq Structure of bovine cytochrome c oxidase crystallized at a neutral pH using a fluorinated detergent.

Chain

Resolution

1.77 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	Y19 V29 L33 I37 V58 H61 N80 D91 N98 S101 L105 W126 S156 S157 G160 T167 H240 E242 Y244 S255 G272 H290 H291 T316 K319 H376 F377 H378 R438 R439
Catalytic site (residue number reindexed from 1)	Y19 V29 L33 I37 V58 H61 N80 D91 N98 S101 L105 W126 S156 S157 G160 T167 H240 E242 Y244 S255 G272 H290 H291 T316 K319 H376 F377 H378 R438 R439
Enzyme Commision number	7.1.1.9: cytochrome-c oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEA	A	A24 T31 S34 I37 R38 Y54 V58 H61 A62 M65 I73 G125 W126 Y371 F377 H378 L381 S382 V386 F393 M417 F425 R438 R439 V465 M468	A24 T31 S34 I37 R38 Y54 V58 H61 A62 M65 I73 G125 W126 Y371 F377 H378 L381 S382 V386 F393 M417 F425 R438 R439 V465 M468
BS02	HEA	A	W126 W236 V243 Y244 I247 H290 H291 T309 A313 T316 G317 G352 G355 I356 L358 A359 D364 H368 V373 H376 F377 V380 L381 R438	W126 W236 V243 Y244 I247 H290 H291 T309 A313 T316 G317 G352 G355 I356 L358 A359 D364 H368 V373 H376 F377 V380 L381 R438
BS03	CU	A	H240 H290 H291	H240 H290 H291
BS04	MG	A	H368 D369	H368 D369

Gene Ontology

	Molecular Function
GO:0004129	cytochrome-c oxidase activity
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0006119	oxidative phosphorylation
GO:0006123	mitochondrial electron transport, cytochrome c to oxygen
GO:0009060	aerobic respiration
GO:0015990	electron transport coupled proton transport

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0016020	membrane
GO:0045277	respiratory chain complex IV

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5xdq, PDBe:5xdq, PDBj:5xdq
PDBsum	5xdq
PubMed	28695851
UniProt	P00396\|COX1_BOVIN Cytochrome c oxidase subunit 1 (Gene Name=MT-CO1)

[Back to BioLiP]