Structure of PDB 5xbn Chain A |
>5xbnA (length=128) Species: 764101 (Saccharomyces cerevisiae FostersO) [Search protein sequence] |
RIPHKNPHIQKVAVLQSKPNKEDALNLIKEIAHKVSYLMKENHFKVTNLV EFYPRDQRLLGMNVNHGSKIMLRLRCSTDEFQFLPMECIMGTMLHELTHN LFGPHDKKFYNKLDELIGRQWVIEQRGL |
|
PDB | 5xbn crystal structure of Wss1 from saccharomyces cerevisiae |
Chain | A |
Resolution | 1.761 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H115 H119 H125 |
H95 H99 H105 |
|
|
|