Structure of PDB 5xao Chain A

Receptor sequence

>5xaoA (length=431) Species: 321614 (Parastagonospora nodorum SN15)

MAPSRANTSVIVVGGGGTIGSSTALHLVRSGYTPSNVTVLDAYPIPSSQS
AGNDLAKIMGVSLRNPVDLQLALEARQMWNEDELFKKFFHNTGRLDCAHG
EKDIADLKSGYQALVDAGLDATNEWLDSEDEILKRMPLLSRDQIKGWKAI
FSKDGGWLAAAKAINAVGEYLRDQGVRFGFYGAGSFKAPLLAEGVCIGVE
TVDGTRYYADKVVLAAGAWSPTLVELHEQCVSKAWVYGHIQLTPEEAARY
KNSPVVYNGDVGFFFEPNEHGVIKVCDEFPGFTRFKMHQPFGAKAPKRIS
VPRSHAKHPTDTIPDASDVSIRRAIATFMPQFKNKKMFNQAMCWCTDTAD
AALLICEHPEWKNFVLATGDSGHSFKLLPNIGKHVVELLEGTLADDLAHA
WRWRPGSGDALKSRRSAPAKDLADMPGWNHD

3D structure

• PDB: 5xao X-ray structures of fructosyl peptide oxidases revealing residues responsible for gating oxygen access in the oxidative half reaction
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N53 A56 K57 K297 V301 C343 K376
• Catalytic site (residue number reindexed from 1): N53 A56 K57 K297 V301 C343 K376

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	G14 G17 T18 I19 D41 A42 S47 Q49 S50 A51 K57 I58 M59 G184 S185 F186 A216 G217 W219 L223 C343 C345 D370 G372 H373 S374 F375 K376	G14 G17 T18 I19 D41 A42 S47 Q49 S50 A51 K57 I58 M59 G184 S185 F186 A216 G217 W219 L223 C343 C345 D370 G372 H373 S374 F375 K376

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0008115 sarcosine oxidase activity
• GO:0016491 oxidoreductase activity
• GO:0050660 flavin adenine dinucleotide binding
• GO:0051698 saccharopine oxidase activity

External links

• PDB: RCSB:5xao, PDBe:5xao, PDBj:5xao
• PDBsum: 5xao
• PubMed: 28584265
• UniProt: Q0UIL6