Structure of PDB 5x9o Chain A |
>5x9oA (length=130) Species: 9606 (Homo sapiens) [Search protein sequence] |
LYFQGADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTV LMACSGLFYSIFTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLRE GNIMAVMATAMYLQMEHVVDTCRKFIKASE |
|
PDB | 5x9o Discovery of a novel B-cell lymphoma 6 (BCL6)-corepressor interaction inhibitor by utilizing structure-based drug design |
Chain | A |
Resolution | 1.58 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
80R |
A |
N21 R24 L25 R28 |
N22 R25 L26 R29 |
MOAD: Kd=5uM PDBbind-CN: -logKd/Ki=5.30,Kd=5uM BindingDB: Kd=5000nM |
|
|