Structure of PDB 5x72 Chain A

Receptor sequence
>5x72A (length=149) Species: 9606 (Homo sapiens) [Search protein sequence]
MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVP
KKILKCKAVSRELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPN
STNTWQSLIEAAPSQMMPASVLTGNVIIETKFFDDDLLVSTSRVRLFYV
3D structure
PDB5x72 Structural Biology-Inspired Discovery of Novel KRAS-PDE delta Inhibitors
ChainA
Resolution1.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 P59 A M20 W32 R61 Q78 I109 V145 M20 W32 R61 Q78 I109 V144 MOAD: Kd=467nM
PDBbind-CN: -logKd/Ki=6.33,Kd=467nM
BS02 P69 A L22 I53 W90 A111 S115 Q116 Y149 L22 I53 W90 A111 S114 Q115 Y148 MOAD: Kd=467nM
Gene Ontology
Molecular Function
GO:0005095 GTPase inhibitor activity
GO:0005515 protein binding
GO:0031267 small GTPase binding
Biological Process
GO:0007601 visual perception
GO:0050953 sensory perception of light stimulus
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005929 cilium
GO:0016020 membrane
GO:0030659 cytoplasmic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0042995 cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5x72, PDBe:5x72, PDBj:5x72
PDBsum5x72
PubMed28929751
UniProtO43924|PDE6D_HUMAN Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta (Gene Name=PDE6D)

[Back to BioLiP]