Structure of PDB 5x6i Chain A

Receptor sequence

>5x6iA (length=212) Species: 1423 (Bacillus subtilis) [Search protein sequence]

MNLVLMGLPGAGKGTQGERIVEDYGTPHISTGDMFRAAMKEETPLGLEAK
SYIDKGELVPDEVTIGIVKERLGKDDCERGFLLDGFPRTVAQAEALEEIL
EEYGKPIDYVINIEVDKDVLMERLTGRRICSVCGTTYHLVFNPPKTPGIC
DKDGGELYQRADDNEETVSKRLEVNMKQTQPLLDFYSEKGYLANVNGQQD
IQDVYADVKDLL

3D structure

PDB

5x6i Structural and mutational analyses of psychrophilic and mesophilic adenylate kinases highlight the role of hydrophobic interactions in protein thermal stability.

Chain

Resolution

2.0 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	K13 R88 R127 R160 R171
Catalytic site (residue number reindexed from 1)	K13 R88 R127 R160 R171
Enzyme Commision number	2.7.4.3: adenylate kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	ZN	A	C130 C133 C150 D153	C130 C133 C150 D153
BS02	AP5	A	P9 G10 G12 K13 G14 T15 T31 G32 R36 I53 E57 V59 T64 G85 R88 Q92 R123 R127 T136 Y137 H138 F141 R160 R171 I201	P9 G10 G12 K13 G14 T15 T31 G32 R36 I53 E57 V59 T64 G85 R88 Q92 R123 R127 T136 Y137 H138 F141 R160 R171 I201
BS03	CA	A	D116 D118	D116 D118

Gene Ontology

	Molecular Function
GO:0004017	adenylate kinase activity
GO:0004550	nucleoside diphosphate kinase activity
GO:0005524	ATP binding
GO:0008270	zinc ion binding
GO:0016301	kinase activity
GO:0016776	phosphotransferase activity, phosphate group as acceptor
GO:0019205	nucleobase-containing compound kinase activity
GO:0046872	metal ion binding
GO:0050145	nucleoside monophosphate kinase activity

	Biological Process
GO:0006139	nucleobase-containing compound metabolic process
GO:0009123	nucleoside monophosphate metabolic process
GO:0009132	nucleoside diphosphate metabolic process
GO:0009165	nucleotide biosynthetic process
GO:0016310	phosphorylation
GO:0044209	AMP salvage
GO:0046940	nucleoside monophosphate phosphorylation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5x6i, PDBe:5x6i, PDBj:5x6i
PDBsum	5x6i
PubMed	31111079
UniProt	P16304\|KAD_BACSU Adenylate kinase (Gene Name=adk)

[Back to BioLiP]