Structure of PDB 5x4p Chain A |
>5x4pA (length=130) Species: 9606 (Homo sapiens) [Search protein sequence] |
LYFQGADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTV LMACSGLFYSIFTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLRE GNIMAVMATAMYLQMEHVVDTCRKFIKASE |
|
PDB | 5x4p Discovery of a B-Cell Lymphoma 6 Protein-Protein Interaction Inhibitor by a Biophysics-Driven Fragment-Based Approach |
Chain | A |
Resolution | 2.06 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
7ZO |
A |
N21 L25 R28 |
N22 L26 R29 |
MOAD: Kd=9.3uM PDBbind-CN: -logKd/Ki=5.03,Kd=9.3uM BindingDB: Kd=9300nM |
|
|