Structure of PDB 5x45 Chain A |
>5x45A (length=136) Species: 463676 (Rhinovirus C) [Search protein sequence] |
GPSDMFVHTRDAIYKCAHLTNPTDETILLALTADLQVDSTNVPGPDVIPC CDCTAGCYYSRSKDRYFPVECVSHDWYEIQESGYYPKHIQYNLLIGEGHC EPGDCGGKLLCKHGVIGMITAGGDNHVAFTDLRPYS |
|
PDB | 5x45 Structural view of the 2A protease from human rhinovirus C15. |
Chain | A |
Resolution | 2.602 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C51 C53 C111 H113 |
C51 C53 C111 H113 |
|
|
|
|