Structure of PDB 5x31 Chain A |
>5x31A (length=125) Species: 511 (Alcaligenes faecalis) [Search protein sequence] |
ASENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDM IPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPAN LDQIVSAKKPKIVQERLEKVIASAK |
|
PDB | 5x31 New molecular packing in a crystal of pseudoazurin from Alcaligenes faecalis: a double-helical arrangement of blue copper |
Chain | A |
Resolution | 2.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H40 C78 H81 M86 |
H42 C80 H83 M88 |
|
|
|
|