Structure of PDB 5wzt Chain A

Receptor sequence
>5wztA (length=123) Species: 9606 (Homo sapiens) [Search protein sequence]
NLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCCY
GRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRN
LGTYNRKYAHYPNKLCTGPTPPC
3D structure
PDB5wzt Structural basis for functional selectivity and ligand recognition revealed by crystal structures of human secreted phospholipase A2 group IIE
ChainA
Resolution2.4 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Y26 G28 G30 H46 D47 Y50 Y65 D90
Catalytic site (residue number reindexed from 1) Y26 G28 G30 H46 D47 Y50 Y65 D90
Enzyme Commision number 3.1.1.4: phospholipase A2.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A Y26 G28 G30 D47 Y26 G28 G30 D47
BS02 7W6 A L2 F5 G6 I9 A17 Y20 N21 C27 G28 I29 C43 H46 D47 F97 L2 F5 G6 I9 A17 Y20 N21 C27 G28 I29 C43 H46 D47 F97 MOAD: ic50=0.22uM
PDBbind-CN: -logKd/Ki=6.66,IC50=0.22uM
Gene Ontology
Molecular Function
GO:0004623 phospholipase A2 activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0005543 phospholipid binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
GO:0047498 calcium-dependent phospholipase A2 activity
Biological Process
GO:0006629 lipid metabolic process
GO:0006644 phospholipid metabolic process
GO:0006954 inflammatory response
GO:0016042 lipid catabolic process
GO:0034374 low-density lipoprotein particle remodeling
GO:0042130 negative regulation of T cell proliferation
GO:0046470 phosphatidylcholine metabolic process
GO:0046471 phosphatidylglycerol metabolic process
GO:0050482 arachidonate secretion
Cellular Component
GO:0005576 extracellular region
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5wzt, PDBe:5wzt, PDBj:5wzt
PDBsum5wzt
PubMed28883454
UniProtQ9NZK7|PA2GE_HUMAN Group IIE secretory phospholipase A2 (Gene Name=PLA2G2E)

[Back to BioLiP]