Structure of PDB 5wt3 Chain A

Receptor sequence

>5wt3A (length=332) Species: 272844 (Pyrococcus abyssi GE5)

MSGVKVRREDAKKVLELLKSVGILDGKRKAIRDEKYVIFPVTDTNIAKSL
GLEVVDVELPMRPERQIYKNLEDLLPREIFKKLGRLDIVGDIAIVSIPDE
ILSEREVIVSAIRKLYPKVKVIARRGFHSGLYRIRELEVIWGENRLHTIH
KENGVLIKVDLSKVFFNPRMKGERYRIAQLVNDGERILVPFAGVIPYPLV
IARFKNVEVYAVEINEFAVKLAEENLELNRDRLKGKIKIIHGDVFEVLPN
LPNFDRVVSPTPKGVDALSLTLSKAEKFLHYYDFVHESEIERFRERVLEE
CRRQGKECRVSVRKVSDYKPHVYKVCADVEIL

3D structure

• PDB: 5wt3 Structural insight into the methyltransfer mechanism of the bifunctional Trm5.
• Chain: A
• Resolution: 3.204 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-
  2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	R8 R62 R65 Q66 I67 Y68 K69 R85 L86 D87 Y116 R125 F127 H128 R133 K151 N153 G154 R169 K171 F284 D317 Y318 K319 P320 H321 Y323	R8 R62 R65 Q66 I67 Y68 K69 R85 L86 D87 Y116 R125 F127 H128 R133 K151 N153 G154 R169 K171 F284 D317 Y318 K319 P320 H321 Y323
BS02	MTA	A	F165 F191 E213 I214 D243 V244	F165 F191 E213 I214 D243 V244

Gene Ontology

Molecular Function

• GO:0008168 methyltransferase activity
• GO:0008175 tRNA methyltransferase activity
• GO:0016740 transferase activity
• GO:0052906 tRNA (guanine(37)-N1)-methyltransferase activity

Biological Process

• GO:0002939 tRNA N1-guanine methylation
• GO:0008033 tRNA processing
• GO:0030488 tRNA methylation
• GO:0032259 methylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5wt3, PDBe:5wt3, PDBj:5wt3
• PDBsum: 5wt3
• PubMed: 29214216
• UniProt: Q9V2G1|TAW22_PYRAB tRNA (guanine(37)-N1)/4-demethylwyosine(37)-methyltransferase Taw22 (Gene Name=taw22)