Structure of PDB 5wrj Chain A

Receptor sequence

>5wrjA (length=275) Species: 9606 (Homo sapiens)

AYHKDMPLIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQM
WSRSSKEKIRLDEAGVTDEVLDSAMQAFLLEIIVKHGEPAPYLCNKDPFA
LKSLTYLSRLFPNAKFLLMVRDGRASVHSMISRKVTIAGFDLNSYRDCLT
KWNRAIETMYNQCMEVGYKKCMLVHYEQLVLHPERWMRTLLKFLQIPWNH
SVLHHEEMIGKAGGVSLSKVERSTDQVIKPVNVGALSKWVGKIPPDVLQD
MAVIAPMLAKLGYDPYANPPNYGKP

3D structure

• PDB: 5wrj Structural basis for the broad substrate specificity of the human tyrosylprotein sulfotransferase-1.
• Chain: A
• Resolution: 2.31 Å

Enzymatic activity

• Enzyme Commision number: 2.8.2.20: protein-tyrosine sulfotransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	P78 E100 R102 R106 T199 I200 A201	P15 E37 R39 R43 T136 I137 A138
BS02	peptide	A	E120 R123	E57 R60
BS03	A3P	A	R79 S80 G81 T82 T83 L84 R184 S192 R196 Y239 S286 Q289 V290 P293 N295 A298 K301	R16 S17 G18 T19 T20 L21 R121 S129 R133 Y176 S223 Q226 V227 P230 N232 A235 K238
BS04	MG	A	D90 H92 P93 I95 G276	D27 H29 P30 I32 G213

Gene Ontology

Molecular Function

• GO:0008476 protein-tyrosine sulfotransferase activity

Biological Process

• GO:0006478 peptidyl-tyrosine sulfation

External links

• PDB: RCSB:5wrj, PDBe:5wrj, PDBj:5wrj
• PDBsum: 5wrj
• PubMed: 28821720
• UniProt: O60507|TPST1_HUMAN Protein-tyrosine sulfotransferase 1 (Gene Name=TPST1)