Structure of PDB 5wri Chain A

Receptor sequence

>5wriA (length=274) Species: 9606 (Homo sapiens)

YHKDMPLIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMW
SRSSKEKIRLDEAGVTDEVLDSAMQAFLLEIIVKHGEPAPYLCNKDPFAL
KSLTYLSRLFPNAKFLLMVRDGRASVHSMISRKVTIAGFDLNSYRDCLTK
WNRAIETMYNQCMEVGYKKCMLVHYEQLVLHPERWMRTLLKFLQIPWNHS
VLHHEEMIGKAGGVSLSKVERSTDQVIKPVNVGALSKWVGKIPPDVLQDM
AVIAPMLAKLGYDPYANPPNYGKP

3D structure

• PDB: 5wri Structural basis for the broad substrate specificity of the human tyrosylprotein sulfotransferase-1.
• Chain: A
• Resolution: 1.6 Å

Enzymatic activity

• Enzyme Commision number: 2.8.2.20: protein-tyrosine sulfotransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	P78 E100 R102 R106 P161 F162 K165 V198 T199 I200 A201 F203 A218 R285	P14 E36 R38 R42 P97 F98 K101 V134 T135 I136 A137 F139 A154 R221
BS02	peptide	A	S117 E120 R123	S53 E56 R59
BS03	A3P	A	R79 S80 G81 T82 T83 R184 S192 R196 Y239 S286 Q289 V290 P293 N295 K301	R15 S16 G17 T18 T19 R120 S128 R132 Y175 S222 Q225 V226 P229 N231 K237
BS04	MG	A	D90 H92 I95 G276	D26 H28 I31 G212

Gene Ontology

Molecular Function

• GO:0008476 protein-tyrosine sulfotransferase activity

Biological Process

• GO:0006478 peptidyl-tyrosine sulfation

External links

• PDB: RCSB:5wri, PDBe:5wri, PDBj:5wri
• PDBsum: 5wri
• PubMed: 28821720
• UniProt: O60507|TPST1_HUMAN Protein-tyrosine sulfotransferase 1 (Gene Name=TPST1)