Structure of PDB 5wq0 Chain A |
>5wq0A (length=123) Species: 1231057 (Paenisporosarcina sp. TG-14) [Search protein sequence] |
KIKVAIADDNKELVKTLESYLADHPQIEVITTAPNGKVILSLMENDLPDV LLLDIIMPHLDGLAVLEMMQANENLSKVQVIMLTAFGQEDVMKQAVDLGA SYFMLKPFEFDRLVNQILQVAGH |
|
PDB | 5wq0 Crystal structure of the inactive state of the receiver domain of Spo0A from Paenisporosarcina sp. TG-14, a psychrophilic bacterium isolated from an Antarctic glacier |
Chain | A |
Resolution | 2.604 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
A |
D11 D56 I58 |
D9 D54 I56 |
|
|
|
|