Structure of PDB 5wjm Chain A

Receptor sequence

>5wjmA (length=216) Species: 10090 (Mus musculus) [Search protein sequence]

DNVPTFPRDYEGPFDVTEGQPGPRVWTFLAHDRDSGPNGQVEYSVVDGDP
LGEFVISPVEGVLRVRKDVELDRETIAFYNLTICARDRGVPPLSSTMLVG
IRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVLASDADSGCNALLTF
NITAGNRERAFFINATTGIVTVNRPLDRERIPEYRLTVSVKDNPENPRIA
RKDFDLLLVSLADEND

3D structure

PDB

5wjm Zooming in on Cadherin-23: Structural Diversity and Potential Mechanisms of Inherited Deafness.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CA	A	D1716 N1717 D1747 D1749 N1753 D1802	D1 N2 D32 D34 N38 D87
BS02	CA	A	E1733 D1787 E1789 D1823	E18 D72 E74 D108
BS03	CA	A	E1733 E1789 D1820 I1821 D1823 D1856	E18 E74 D105 I106 D108 D141
BS04	CA	A	N1822 N1824 D1854 D1856 N1860 D1907	N107 N109 D139 D141 N145 D192
BS05	CA	A	E1839 E1894 D1928 E1929 D1931	E124 E179 D213 E214 D216
BS06	CA	A	E1839 D1892 E1894 D1931	E124 D177 E179 D216

Gene Ontology

	Molecular Function
GO:0005509	calcium ion binding

	Biological Process
GO:0007155	cell adhesion
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5wjm, PDBe:5wjm, PDBj:5wjm
PDBsum	5wjm
PubMed	30033219
UniProt	Q99PF4\|CAD23_MOUSE Cadherin-23 (Gene Name=Cdh23)

[Back to BioLiP]