Structure of PDB 5wii Chain A |
>5wiiA (length=141) Species: 562 (Escherichia coli) [Search protein sequence] |
DQTSYGDEIDKFWLTQYVIHRESYDFYSVQVDYTAVGLMSTPNVAESYQS KFKGRNGLDKVLGDSETTRVKINSVILDKPHGVATIRFTTVRRVRSNPVD DQPQRWIAIMGYEYKSLAMNAEQRYVNPLGFRVTSYRVNPE |
|
PDB | 5wii Fragment-based screening identifies novel targets for inhibitors of conjugative transfer of antimicrobial resistance by plasmid pKM101. |
Chain | A |
Resolution | 2.79 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
AO4 |
A |
R110 E111 S112 |
R21 E22 S23 |
PDBbind-CN: -logKd/Ki=4.49,Kd=32uM |
|
|
|